Research
Security News
Malicious npm Package Targets Solana Developers and Hijacks Funds
A malicious npm package targets Solana developers, rerouting funds in 2% of transactions to a hardcoded address.
FastaFrames is a python package to convert between FASTA files and pandas DataFrames.
To install fastaframes use pip:
pip install fastaframes
from fastaframes import to_df
fasta_df = to_df(data='example.fasta')
from fastaframes import to_fasta
to_fasta(data=fasta_df, output_file='output.fasta')
>sp|A0A087X1C5|CP2D7_HUMAN Putative cytochrome P450 2D7 OS=Homo sapiens OX=9606 GN=CYP2D7 PE=5 SV=1
MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ
db | unique_identifier | entry_name | protein_name | organism_name | organism_identifier | gene_name | protein_existence | sequence_version | protein_sequence | |
---|---|---|---|---|---|---|---|---|---|---|
0 | sp | A0A087X1C5 | CP2D7_HUMAN | Putative cytochrome P450 2D7 | Homo sapiens | 9606.0 | CYP2D7 | 5.0 | 1.0 | MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ |
FAQs
A very simple fasta file parser.
We found that fastaframes demonstrated a healthy version release cadence and project activity because the last version was released less than a year ago. It has 1 open source maintainer collaborating on the project.
Did you know?
Socket for GitHub automatically highlights issues in each pull request and monitors the health of all your open source dependencies. Discover the contents of your packages and block harmful activity before you install or update your dependencies.
Research
Security News
A malicious npm package targets Solana developers, rerouting funds in 2% of transactions to a hardcoded address.
Security News
Research
Socket researchers have discovered malicious npm packages targeting crypto developers, stealing credentials and wallet data using spyware delivered through typosquats of popular cryptographic libraries.
Security News
Socket's package search now displays weekly downloads for npm packages, helping developers quickly assess popularity and make more informed decisions.