Security News
Input Validation Vulnerabilities Dominate MITRE's 2024 CWE Top 25 List
MITRE's 2024 CWE Top 25 highlights critical software vulnerabilities like XSS, SQL Injection, and CSRF, reflecting shifts due to a refined ranking methodology.
bionode-fasta
Advanced tools
FASTA format parser for bionode
Install bionode-fasta
with npm:
$ npm install bionode-fasta
To use it as a command line tool, you can install it globally by adding -g
.
Alternatively, just include bionode-fasta.min.js
via a <script/>
in your page.
If you are using bionode-fasta
with Node.js, you can require the module:
var bionodeFasta = require('bionode-fasta')
//Sample FASTA file
console.log(sampleFASTA);
=> >SEQUENCE_1
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG
LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK
IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL
MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL
>SEQUENCE_2
SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI
ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH
bionodeFasta.readFasta(sampleFASTA);
=> [ { name: 'SEQUENCE_1',
seq: 'MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEGLVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHKIPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTLMGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL' },
{ name: 'SEQUENCE_2',
seq: 'SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQIATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH' } ]
Please read the documentation for the methods exposed by bionode-fasta.
$ bionode-fasta readFasta ~/sequences.fa
To contribute, clone this repo locally and commit your code on a separate branch.
Please write unit tests for your code, and check that everything works by running the following before opening a pull-request:
$ npm test
Please also check for code coverage:
$ npm run coverage
To rebuild and minify the module for the browser:
$ npm run build-browser
To rebuild the documentation using the comments in the code:
$ npm run build-docs
Check the issues for ways to contribute.
Alan Rice <alanmrice@gmail.com> @alanmrice
bionode-fasta is licensed under the MIT license.
Check ChooseALicense.com for details.
FAQs
Streamable FASTA parser
The npm package bionode-fasta receives a total of 10 weekly downloads. As such, bionode-fasta popularity was classified as not popular.
We found that bionode-fasta demonstrated a not healthy version release cadence and project activity because the last version was released a year ago. It has 3 open source maintainers collaborating on the project.
Did you know?
Socket for GitHub automatically highlights issues in each pull request and monitors the health of all your open source dependencies. Discover the contents of your packages and block harmful activity before you install or update your dependencies.
Security News
MITRE's 2024 CWE Top 25 highlights critical software vulnerabilities like XSS, SQL Injection, and CSRF, reflecting shifts due to a refined ranking methodology.
Security News
In this segment of the Risky Business podcast, Feross Aboukhadijeh and Patrick Gray discuss the challenges of tracking malware discovered in open source softare.
Research
Security News
A threat actor's playbook for exploiting the npm ecosystem was exposed on the dark web, detailing how to build a blockchain-powered botnet.